PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009140275.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SRS
Protein Properties Length: 190aa    MW: 21245.2 Da    PI: 9.1642
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009140275.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702190.65.7e-5961484154
          DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskk 98 
                     ++ +C+dCGnqakk+C+++RCRtCCk+++f+C+th+kstWvpa++r++++q ++ ++ +   ++  + +++kr  +++ +s+ ss+ +       
  XP_009140275.1   6 TGRRCEDCGNQAKKECVYMRCRTCCKAKAFHCQTHIKSTWVPAYRRSHKHQSQTPPQPQ---QQPLSITNSKRLIEQHPTSSPSSSGVR-----I 92 
                     5679*******************************************997776665433...345566666666655555555555544.....4 PP

          DUF702  99 eletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      ++t ++P+e+ss a frcv+vss+ddg+e++aYqt+v+igGhv +GiL+dqGle+
  XP_009140275.1  93 GTSTGHFPAELSSVADFRCVKVSSIDDGKEQYAYQTTVNIGGHVIRGILHDQGLEK 148
                     566799***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.4E-567147IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.4E-271051IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.9E-2898146IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MIMMVTGRRC EDCGNQAKKE CVYMRCRTCC KAKAFHCQTH IKSTWVPAYR RSHKHQSQTP  60
PQPQQQPLSI TNSKRLIEQH PTSSPSSSGV RIGTSTGHFP AELSSVADFR CVKVSSIDDG  120
KEQYAYQTTV NIGGHVIRGI LHDQGLEKVV LDHQPAHHDQ ALLLPSSSRP LMITSHFTDF  180
MSGNHTKSLH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0068415e-59AC006841.7 Arabidopsis thaliana chromosome 2 clone F3K23 map mi148, complete sequence.
GenBankCP0026855e-59CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140275.11e-142PREDICTED: protein SHI RELATED SEQUENCE 3
SwissprotQ9SJT83e-83SRS3_ARATH; Protein SHI RELATED SEQUENCE 3
TrEMBLM4END11e-142M4END1_BRARP; Uncharacterized protein
STRINGBra030301.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91882638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21400.12e-82SHI-related sequence3